DRG1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: DRG1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3987
• Supplier Catalog Number: A3987
• Alternative Catalog Number: ABB-A3987-20UL,ABB-A3987-100UL,ABB-A3987-500UL,ABB-A3987-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NEDD3, DRG1

Product Description

Enables several functions, including GTPase activity, identical protein binding activity, and potassium ion binding activity. Involved in positive regulation of microtubule polymerization and regulation of mitotic spindle assembly. Located in cytosol and nuclear body. Part of polysome.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 41kDa
• NCBI: 4733
• UniProt: Q9Y295
• Purity: Affinity purification
• Sequence: KKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK
• Target: DRG1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor suppressors,Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation. Shipping: Ice Bag

Images

Western blot analysis of various lysates using DRG1 Rabbit pAb (A3987) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.