QSOX1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: QSOX1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4060
• Supplier Catalog Number: A4060
• Alternative Catalog Number: ABB-A4060-20UL,ABB-A4060-100UL,ABB-A4060-500UL,ABB-A4060-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Q6, QSCN6, QSOX1

Product Description

This gene encodes a protein that contains domains of thioredoxin and ERV1, members of two long-standing gene families. The gene expression is induced as fibroblasts begin to exit the proliferative cycle and enter quiescence, suggesting that this gene plays an important role in growth regulation. Two transcript variants encoding two different isoforms have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 83kDa
• NCBI: 5768
• UniProt: O00391
• Purity: Affinity purification
• Sequence: MRRCNSGSGPPPSLLLLLLWLLAVPGANAAPRSALYSPSDPLTLLQADTVRGAVLGSRSAWAVEFFASWCGHCIAFAPTWKALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPTVRFFKAFTKNGSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFFARNNEEYLALIFEKGGSYLGREVALDLSQHKGVAVRRVLNTEANVVRKFGVTDFPSCYLLFRNGSVSRVPVLMES
• Target: QSOX1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors. Shipping: Ice Bag

Images

Western blot analysis of various lysates using QSOX1 Rabbit pAb (A4060) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.