UCP2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: UCP2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4178
• Supplier Catalog Number: A4178
• Alternative Catalog Number: ABB-A4178-20UL,ABB-A4178-100UL,ABB-A4178-500UL,ABB-A4178-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: UCPH, BMIQ4, SLC25A8, UCP2

Product Description

Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed in many tissues, with the greatest expression in skeletal muscle. It is thought to play a role in nonshivering thermogenesis, obesity and diabetes. Chromosomal order is 5-UCP3-UCP2-3.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 33kDa
• NCBI: 7351
• UniProt: P55851
• Purity: Affinity purification
• Sequence: EHASIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNCAELVTYDLIKDALLKANLMT
• Target: UCP2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Endocrine Metabolism,Warburg Effect,Endocrine and metabolic diseases,Obesity. Shipping: Ice Bag

Images

Western blot analysis of various lysates using UCP2 Rabbit pAb (A4178) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.