STAM Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A4198
Article Name: STAM Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A4198
Supplier Catalog Number: A4198
Alternative Catalog Number: ABB-A4198-20UL,ABB-A4198-100UL,ABB-A4198-1000UL,ABB-A4198-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: STAM1, STAM-1, STAM
This gene encodes a member of the signal-transducing adaptor molecule family. These proteins mediate downstream signaling of cytokine receptors and also play a role in ER to Golgi trafficking by interacting with the coat protein II complex. The encoded protein also associates with hepatocyte growth factor-regulated substrate to form the endosomal sorting complex required for transport-0 (ESCRT-0), which sorts ubiquitinated membrane proteins to the ESCRT-1 complex for lysosomal degradation. Alternatively spliced transcript variants have been observed for this gene.
Clonality: Polyclonal
Molecular Weight: 59kDa
NCBI: 8027
UniProt: Q92783
Purity: Affinity purification
Sequence: KNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQH
Target: STAM
Antibody Type: Primary Antibody
Application Dilute: WB,1:200 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation. Shipping: Ice Bag
Western blot analysis of various lysates using STAM Rabbit pAb (A4198) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.