VAMP4 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: VAMP4 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4241
• Supplier Catalog Number: A4241
• Alternative Catalog Number: ABB-A4241-20UL,ABB-A4241-100UL,ABB-A4241-500UL,ABB-A4241-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: VAMP-4, VAMP24, VAMP4

Product Description

Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. This protein may play a role in trans-Golgi network-to-endosome transport.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 16kDa
• NCBI: 8674
• UniProt: O75379
• Purity: Affinity purification
• Sequence: MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCK
• Target: VAMP4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag

Images

Western blot analysis of various lysates using VAMP4 Rabbit pAb (A4241) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.