TIMM10 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: TIMM10 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4626
• Supplier Catalog Number: A4626
• Alternative Catalog Number: ABB-A4626-20UL,ABB-A4626-100UL,ABB-A4626-500UL,ABB-A4626-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: TIM10, TIM10A, TIMM10A, TIMM10

Product Description

The mitochondrial protein encoded by this gene belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane, functioning as intermembrane space chaperones for the highly insoluble carrier proteins.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 10kDa
• NCBI: 26519
• UniProt: P62072
• Purity: Affinity purification
• Sequence: MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA
• Target: TIMM10
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag

Images

Western blot analysis of various lysates, using TIMM10 Rabbit pAb (A4626) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.