SIGLEC9 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SIGLEC9 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4648
• Supplier Catalog Number: A4648
• Alternative Catalog Number: ABB-A4648-20UL,ABB-A4648-100UL,ABB-A4648-500UL,ABB-A4648-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CD329, CDw329, FOAP-9, siglec-9, OBBP-LIKE, SIGLEC9

Product Description

Predicted to enable monosaccharide binding activity and sialic acid binding activity. Predicted to be involved in cell adhesion. Predicted to act upstream of or within negative regulation of inflammatory response and negative regulation of phagocytosis, engulfment. Predicted to be located in external side of plasma membrane. Predicted to be active in plasma membrane.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 50kDa
• NCBI: 27180
• UniProt: Q9Y336
• Purity: Affinity purification
• Sequence: SLTCQVTFPGASVTTNKTVHLNVSYPPQNLTMTVFQGDGTVSTVLGNGSSLSLPEGQSLRLVCAVDAVDSNPPARLSLSWRGLTLCPSQPSNPGVLELPWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSK
• Target: SIGLEC9
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,Cardiovascular,Blood. Shipping: Ice Bag

Images

Western blot analysis of various lysates using SIGLEC9 Rabbit pAb (A4648) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.