TBX21 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: TBX21 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4682
• Supplier Catalog Number: A4682
• Alternative Catalog Number: ABB-A4682-20UL,ABB-A4682-500UL,ABB-A4682-100UL,ABB-A4682-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: TBET, IMD88, T-PET, T-bet, TBLYM, TBX21

Product Description

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 58kDa
• NCBI: 30009
• UniProt: Q9UL17
• Purity: Affinity purification
• Sequence: KGFRENFESMYTSVDTSIPSPPGPNCQFLGGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYYRGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEIAPIRPESSDSGLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKEAEGQFYNYFPN
• Target: TBX21

Application Notes

• Application Dilute: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Immunology Inflammation,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag

Images

Western blot analysis of lysates from Rat lung, using TBX21 Rabbit pAb (A4682) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.