RHOF Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A4786
Article Name: RHOF Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A4786
Supplier Catalog Number: A4786
Alternative Catalog Number: ABB-A4786-20UL,ABB-A4786-100UL,ABB-A4786-1000UL,ABB-A4786-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RIF, ARHF, RHOF
Predicted to enable GTP binding activity, GTPase activity, and protein kinase binding activity. Involved in actin filament organization. Located in extracellular exosome.
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 54509
UniProt: Q9HBH0
Purity: Affinity purification
Sequence: SQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHF
Target: RHOF
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag
Western blot analysis of various lysates using RHOF Rabbit pAb (A4786) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.