HAUS6 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: HAUS6 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4797
• Supplier Catalog Number: A4797
• Alternative Catalog Number: ABB-A4797-100UL,ABB-A4797-20UL,ABB-A4797-1000UL,ABB-A4797-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Dgt6, FAM29A, HAUS6

Product Description

The protein encoded by this gene is a subunit of the augmin complex. The augmin complex plays a role in microtubule attachment to the kinetochore and central spindle formation. This protein may have a role in efficient chromosome congression and segregation by promoting microtubule-dependent microtubule amplification. Pseudogenes of this gene are located on chromosomes 7 and 20. Alternative splicing results in multiple transcript variants that encode different protein isoforms.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 109kDa
• NCBI: 54801
• UniProt: Q7Z4H7
• Purity: Affinity purification
• Sequence: DEPPTQNQSDLLNKKVICKQDLECLAFTKLSETSRMETFSPAVGNRIDVMGGSEEEFMKILDHLEVSCNKPSTNKTMLWNSFQISSGISSKSFKDNDFGILHETLPEEVGHLSFNSSSSSEANFKLEPNSPMHGGTLLEDVVGGRQTTPESDFNLQALRSRYEALKKSLSKKREESYLSNSQTPERHKPELSPTPQNVQTDDTLNFLDTCDLHTEHIKPSLRTSIGERKRSLSPLIKFSPVEQRLRTTIACSLGE
• Target: HAUS6
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cell differentiation. Shipping: Ice Bag

Images

Western blot analysis of various lysates using HAUS6 Rabbit pAb (A4797) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.