EIF5A2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: EIF5A2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4864
• Supplier Catalog Number: A4864
• Alternative Catalog Number: ABB-A4864-20UL,ABB-A4864-100UL,ABB-A4864-500UL,ABB-A4864-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: EIF-5A2, eIF5AII, EIF5A2

Product Description

Predicted to enable translation elongation factor activity. Predicted to be involved in positive regulation of translational elongation. Located in intracellular membrane-bounded organelle.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 17kDa
• NCBI: 56648
• UniProt: Q9GZV4
• Purity: Affinity purification
• Sequence: MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
• Target: EIF5A2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag

Images

Western blot analysis of various lysates using EIF5A2 Rabbit pAb (A4864) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.