CDK5RAP3 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CDK5RAP3 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5000
• Supplier Catalog Number: A5000
• Alternative Catalog Number: ABB-A5000-100UL,ABB-A5000-20UL,ABB-A5000-1000UL,ABB-A5000-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: C53, IC53, LZAP, HSF-27, MST016, PP1553, OK/SW-cl.114, CDK5RAP3

Product Description

This gene encodes a protein that has been reported to function in signaling pathways governing transcriptional regulation and cell cycle progression. It may play a role in tumorigenesis and metastasis. A pseudogene of this gene is located on the long arm of chromosome 20. Alternative splicing results in multiple transcript variants that encode different isoforms.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 57kDa
• NCBI: 80279
• UniProt: Q96JB5
• Purity: Affinity purification
• Sequence: MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHL
• Target: CDK5RAP3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers,Signal Transduction,Kinase,Cell Biology Developmental Biology,Apoptosis,Cell Cycle. Shipping: Ice Bag

Images

Western blot analysis of various lysates using CDK5RAP3 Rabbit pAb (A5000) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.