REG1A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A5327
Article Name: REG1A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A5327
Supplier Catalog Number: A5327
Alternative Catalog Number: ABB-A5327-20UL,ABB-A5327-100UL,ABB-A5327-500UL,ABB-A5327-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: P19, PSP, PTP, REG, ICRF, PSPS, PSPS1, REG1A
This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. Reg family members REG1B, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication.
Clonality: Polyclonal
Molecular Weight: 19kDa
NCBI: 5967
UniProt: P05451
Purity: Affinity purification
Sequence: FNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWK
Target: REG1A
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers,Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using REG1A Rabbit pAb (A5327) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.