C1QB Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: C1QB Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5339
• Supplier Catalog Number: A5339
• Alternative Catalog Number: ABB-A5339-100UL,ABB-A5339-20UL,ABB-A5339-500UL,ABB-A5339-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: C1QD2, C1QB

Product Description

This gene encodes the B-chain polypeptide of serum complement subcomponent C1q, which associates with C1r and C1s to yield the first component of the serum complement system. C1q is composed of 18 polypeptide chains which include 6 A-chains, 6 B-chains, and 6 C-chains. Each chain contains an N-terminal collagen-like region and a C-terminal C1q globular domain. C1q deficiency is associated with lupus erythematosus and glomerulonephritis.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 27kDa
• NCBI: 713
• UniProt: P02746
• Purity: Affinity purification
• Sequence: PGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA
• Target: C1QB
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease. Shipping: Ice Bag

Images

Western blot analysis of lysates from wild type (WT) and293T cells transfected withC1QB usingC1QB Rabbit pAb (A5339) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:5s.