PAX4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A5414
Article Name: PAX4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A5414
Supplier Catalog Number: A5414
Alternative Catalog Number: ABB-A5414-100UL,ABB-A5414-20UL,ABB-A5414-1000UL,ABB-A5414-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: KPD, MODY9, PAX4
This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The paired box 4 gene is involved in pancreatic islet development and mouse studies have demonstrated a role for this gene in differentiation of insulin-producing beta cells.
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 5078
UniProt: O43316
Purity: Affinity purification
Sequence: LGRYYRTGVLEPKGIGGSKPRLATPPVVARIAQLKGECPALFAWEIQRQLCAEGLCTQDKTPSVSSINRVLRALQEDQGLPCTRLRSPAVLAPAVLTPHSGSETPRGTHPGTGHRNRTIFSPSQAEALEKEFQRGQYPDSVARGKLATATS
Target: PAX4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of lysates from Lovo cells, using PAX4 Rabbit pAb (A5414) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.