ROR2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: ROR2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5620
• Supplier Catalog Number: A5620
• Alternative Catalog Number: ABB-A5620-20UL,ABB-A5620-100UL,ABB-A5620-1000UL,ABB-A5620-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: BDB, BDB1, NTRKR2, ROR2

Product Description

The protein encoded by this gene is a receptor protein tyrosine kinase and type I transmembrane protein that belongs to the ROR subfamily of cell surface receptors. The protein may be involved in the early formation of the chondrocytes and may be required for cartilage and growth plate development. Mutations in this gene can cause brachydactyly type B, a skeletal disorder characterized by hypoplasia/aplasia of distal phalanges and nails. In addition, mutations in this gene can cause the autosomal recessive form of Robinow syndrome, which is characterized by skeletal dysplasia with generalized limb bone shortening, segmental defects of the spine, brachydactyly, and a dysmorphic facial appearance.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 105kDa
• NCBI: 4920
• UniProt: Q01974
• Purity: Affinity purification
• Sequence: APVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGMKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGIACARFIGNRTIYVDSLQMQG
• Target: ROR2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Bone,Stem Cells,Mesenchymal Stem Cells. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse embryo, using ROR2 Rabbit pAb (A5620) at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.