LAT Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: LAT Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5650
• Supplier Catalog Number: A5650
• Alternative Catalog Number: ABB-A5650-20UL,ABB-A5650-100UL,ABB-A5650-500UL,ABB-A5650-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: LAT1, pp36, IMD52, LAT

Product Description

The protein encoded by this gene is phosphorylated by ZAP-70/Syk protein tyrosine kinases following activation of the T-cell antigen receptor (TCR) signal transduction pathway. This transmembrane protein localizes to lipid rafts and acts as a docking site for SH2 domain-containing proteins. Upon phosphorylation, this protein recruits multiple adaptor proteins and downstream signaling molecules into multimolecular signaling complexes located near the site of TCR engagement. Alternative splicing results in multiple transcript variants encoding different isoforms.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 28kDa
• NCBI: 27040
• UniProt: O43561
• Purity: Affinity purification
• Sequence: PSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN
• Target: LAT
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Protein phosphorylation,Signal Transduction,G protein signaling,Small G proteins,Immunology Inflammation,T Cell Receptor Signaling Pathway. Shipping: Ice Bag

Images

Western blot analysis of lysates from THP-1 cells, using LAT Rabbit pAb (A5650) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.