CD58 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A5684
Article Name: CD58 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A5684
Supplier Catalog Number: A5684
Alternative Catalog Number: ABB-A5684-20UL,ABB-A5684-100UL,ABB-A5684-500UL,ABB-A5684-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ag3, LFA3, LFA-3, CD58
This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes. The protein is localized to the plasma membrane. Alternatively spliced transcript variants have been described.
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 965
UniProt: P19256
Purity: Affinity purification
Sequence: NVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIP
Target: CD58
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Immunology Inflammation,CDs. Shipping: Ice Bag
Western blot analysis of various lysates using CD58 Rabbit pAb (A5684) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.