FOXP3 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: FOXP3 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5706
• Supplier Catalog Number: A5706
• Alternative Catalog Number: ABB-A5706-100UL,ABB-A5706-20UL,ABB-A5706-1000UL,ABB-A5706-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: JM2, AIID, IPEX, PIDX, XPID, DIETER, FOXP3

Product Description

The protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX), also known as X-linked autoimmunity-immunodeficiency syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 47kDa
• NCBI: 50943
• UniProt: Q9BZS1
• Purity: Affinity purification
• Sequence: KVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPRE
• Target: FOXP3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Cell Cycle,Immunology Inflammation. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse thymus , using FOXP3 Rabbit pAb (A5706) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.