CDX1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CDX1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5712
• Supplier Catalog Number: A5712
• Alternative Catalog Number: ABB-A5712-20UL,ABB-A5712-100UL,ABB-A5712-500UL,ABB-A5712-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CDX1

Product Description

This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 28kDa
• NCBI: 1044
• UniProt: P47902
• Purity: Affinity purification
• Sequence: MRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPPQPPMAHDITATPAGPSLGGLCPSNTSLLATSSPMPVKEEFLP
• Target: CDX1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag

Images

Western blot analysis of various lysates using CDX1 Rabbit pAb (A5712) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.