BIRC7 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: BIRC7 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5736
• Supplier Catalog Number: A5736
• Alternative Catalog Number: ABB-A5736-20UL,ABB-A5736-100UL,ABB-A5736-1000UL,ABB-A5736-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: KIAP, LIVIN, MLIAP, RNF50, ML-IAP, BIRC7

Product Description

This gene encodes a member of the inhibitor of apoptosis protein (IAP) family, and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with caspases, while the RING finger domain sometimes enhances antiapoptotic activity but does not inhibit apoptosis alone. Elevated levels of the encoded protein may be associated with cancer progression and play a role in chemotherapy sensitivity. Alternative splicing results in multiple transcript variants

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 33kDa
• NCBI: 79444
• UniProt: Q96CA5
• Purity: Affinity purification
• Sequence: MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVEAQLRRLQEERTCKVC
• Target: BIRC7
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Invasion and Metastasis,Cell Biology Developmental Biology,Apoptosis,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag

Images

Western blot analysis of various lysates using BIRC7 Rabbit pAb (A5736) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.