DAP Kinase 1 (DAPK1) Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: DAP Kinase 1 (DAPK1) Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5741
• Supplier Catalog Number: A5741
• Alternative Catalog Number: ABB-A5741-100UL,ABB-A5741-20UL,ABB-A5741-500UL,ABB-A5741-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: DAPK, ROCO3, DAP Kinase 1 (DAPK1)

Product Description

Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160-kD calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consensus sites. It is a tumor suppressor candidate. Alternative splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 160kDa
• NCBI: 1612
• UniProt: P53355
• Purity: Affinity purification
• Sequence: PCGIFHKVQVNLCRWIHQQSTEGDADIRLWVNGCKLANRGAELLVLLVNHGQGIEVQVRGLETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPPDPLGKDWCLLAMNLGLPDLVAKYNTSNGAPKDFLPSPLHALLREWTTYPESTVGTLMSKLRELGRRDAADFLLKA
• Target: DAPK1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor suppressors,Signal Transduction,Kinase,Serine threonine kinases,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Autophagy,Death Receptor Signaling Pathway,Neuroscience,Calcium Signaling. Shipping: Ice Bag

Images

Western blot analysis of various lysates using DAP Kinase 1 (DAPK1) Rabbit pAb (A5741) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.