ATM Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: ATM Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5908
• Supplier Catalog Number: A5908
• Alternative Catalog Number: ABB-A5908-100UL,ABB-A5908-20UL,ABB-A5908-1000UL,ABB-A5908-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: AT1, ATA, ATC, ATD, ATE, ATDC, TEL1, TELO1, ATM

Product Description

The protein encoded by this gene belongs to the PI3/PI4-kinase family. This protein is an important cell cycle checkpoint kinase that phosphorylates, thus, it functions as a regulator of a wide variety of downstream proteins, including tumor suppressor proteins p53 and BRCA1, checkpoint kinase CHK2, checkpoint proteins RAD17 and RAD9, and DNA repair protein NBS1. This protein and the closely related kinase ATR are thought to be master controllers of cell cycle checkpoint signaling pathways that are required for cell response to DNA damage and for genome stability. Mutations in this gene are associated with ataxia telangiectasia, an autosomal recessive disorder.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 351kDa
• NCBI: 472
• UniProt: Q13315
• Purity: Affinity purification
• Sequence: CLDKKSQRTMLAVVDYMRRQKRPSSGTIFNDAFWLDLNYLEVAKVAQSCAAHFTALLYAEIYADKKSMDDQEKRSLAFEEGSQSTTISSLSEKSKEETGIS
• Target: ATM
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,DNA Damage Repair,Protein phosphorylation,Cancer,Tumor suppressors,Signal Transduction,Kinase,Serine threonine kinases,ATM Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Cell Cycle,Cell Cycle Control-G1 S Checkpoint,Cell Cycle Control-G2 M DNA Damage Checkpoint,Immunology Inflammation,NF-kB Signaling Pathway. Shipping: Ice Bag

Images

Western blot analysis of lysates from H460 cells, using ATM Rabbit pAb (A5908) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.