MAGOH Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: MAGOH Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6035
• Supplier Catalog Number: A6035
• Alternative Catalog Number: ABB-A6035-20UL,ABB-A6035-100UL,ABB-A6035-500UL,ABB-A6035-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MAGOH1, MAGOHA, MAGOH

Product Description

Drosophila that have mutations in their mago nashi (grandchildless) gene produce progeny with defects in germplasm assembly and germline development. This gene encodes the mammalian mago nashi homolog. In mammals, mRNA expression is not limited to the germ plasm, but is expressed ubiquitously in adult tissues and can be induced by serum stimulation of quiescent fibroblasts.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 17kDa
• NCBI: 4116
• UniProt: P61326
• Purity: Affinity purification
• Sequence: MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI
• Target: MAGOH
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag

Images

Western blot analysis of various lysates using MAGOH Rabbit pAb (A6035) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.