LRP6 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: LRP6 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6134
• Supplier Catalog Number: A6134
• Alternative Catalog Number: ABB-A6134-20UL,ABB-A6134-500UL,ABB-A6134-100UL,ABB-A6134-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ADCAD2, STHAG7, LRP6

Product Description

This gene encodes a member of the low density lipoprotein (LDL) receptor gene family. LDL receptors are transmembrane cell surface proteins involved in receptor-mediated endocytosis of lipoprotein and protein ligands. The protein encoded by this gene functions as a receptor or, with Frizzled, a co-receptor for Wnt and thereby transmits the canonical Wnt/beta-catenin signaling cascade. Through its interaction with the Wnt/beta-catenin signaling cascade this gene plays a role in the regulation of cell differentiation, proliferation, and migration and the development of many cancer types. This protein undergoes gamma-secretase dependent RIP- (regulated intramembrane proteolysis) processing but the precise locations of the cleavage sites have not been determined.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 180kDa
• NCBI: 4040
• UniProt: O75581
• Purity: Affinity purification
• Sequence: DAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
• Target: LRP6

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Protein phosphorylation,Signal Transduction,mTOR Signaling Pathway,Cell Biology Developmental Biology,Microtubules,Wnt -Catenin Signaling Pathway,ESC Pluripotency and Differentiation,Stem Cells. Shipping: Ice Bag

Images

Western blot analysis of various lysates using LRP6 Rabbit pAb (A6134) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.