IL31RA Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: IL31RA Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6141
• Supplier Catalog Number: A6141
• Alternative Catalog Number: ABB-A6141-100UL,ABB-A6141-20UL,ABB-A6141-500UL,ABB-A6141-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CRL, GPL, CRL3, GLMR, GLM-R, PLCA2, hGLM-R, IL-31RA, PRO21384, zcytoR17, IL31RA

Product Description

The protein encoded by this gene belongs to the type I cytokine receptor family. This receptor, with homology to gp130, is expressed on monocytes, and is involved in IL-31 signaling via activation of STAT-3 and STAT-5. It functions either as a monomer, or as part of a receptor complex with oncostatin M receptor (OSMR). Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 83kDa
• NCBI: 133396
• UniProt: Q8NI17
• Purity: Affinity purification
• Sequence: VKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEYVIALRCAVKESKFWSDWSQEKMGMTEEEAPCGLELWRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPESNTNLTETMNTTNQQLELHLGGESFWVSMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKWQSSALDVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQ
• Target: IL31RA
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Apoptosis,Immunology Inflammation,Cytokines,Interleukins,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag

Images

Western blot analysis of lysates from U-87MG cells, using IL31RA Rabbit pAb (A6141) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.