VASH1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: VASH1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6148
• Supplier Catalog Number: A6148
• Alternative Catalog Number: ABB-A6148-20UL,ABB-A6148-100UL,ABB-A6148-1000UL,ABB-A6148-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: TTCP 1, KIAA1036, VASH1

Product Description

Enables actin binding activity and metallocarboxypeptidase activity. Involved in negative regulation of angiogenesis, negative regulation of blood vessel endothelial cell migration, and proteolysis. Acts upstream of or within several processes, including negative regulation of endothelial cell migration, negative regulation of endothelial cell proliferation, and negative regulation of lymphangiogenesis. Located in apical part of cell, endoplasmic reticulum, and extracellular space. Implicated in liver cirrhosis and portal hypertension. Biomarker of liver cirrhosis.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 41kDa
• NCBI: 22846
• UniProt: Q7L8A9
• Purity: Affinity purification
• Sequence: MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGIYLTNSMPTLERFPISFKTYFSGNYFRHIVLGVNFAGRYGALGMSRREDLMYKPPAFRTLSELVLDFEAAYGRCWHVLK
• Target: VASH1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Cardiovascular,Angiogenesis. Shipping: Ice Bag

Images

Western blot analysis of various lysates using VASH1 Rabbit pAb (A6148) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.