KCNJ5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A6232
Article Name: KCNJ5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A6232
Supplier Catalog Number: A6232
Alternative Catalog Number: ABB-A6232-100UL,ABB-A6232-20UL,ABB-A6232-500UL,ABB-A6232-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CIR, GIRK4, KATP1, LQT13, KIR3.4, KCNJ5
This gene encodes an integral membrane protein which belongs to one of seven subfamilies of inward-rectifier potassium channel proteins called potassium channel subfamily J. The encoded protein is a subunit of the potassium channel which is homotetrameric. It is controlled by G-proteins and has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Naturally occurring mutations in this gene are associated with aldosterone-producing adenomas.
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 3762
UniProt: P48544
Purity: Affinity purification
Sequence: RQRYMEKSGKCNVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDHVGDQEWIPCVENLSGFVSAFLFSIETETTI
Target: KCNJ5
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Neuroscience,Cardiovascular,Heart,Cardiac arrhythmias. Shipping: Ice Bag
Western blot analysis of various lysates using KCNJ5 Rabbit pAb (A6232) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.