GAB1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A6248
Article Name: GAB1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A6248
Supplier Catalog Number: A6248
Alternative Catalog Number: ABB-A6248-100UL,ABB-A6248-20UL,ABB-A6248-500UL,ABB-A6248-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DFNB26, GAB1
The protein encoded by this gene is a member of the IRS1-like multisubstrate docking protein family. It is an important mediator of branching tubulogenesis and plays a central role in cellular growth response, transformation and apoptosis. Two transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 77kDa
NCBI: 2549
UniProt: Q13480
Purity: Affinity purification
Sequence: PNLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPAKSVK
Target: GAB1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Cancer,Signal Transduction,Kinase,PI3K-Akt Signaling Pathway,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell differentiation,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway. Shipping: Ice Bag
Western blot analysis of lysates from SH-SY5Y cells, using GAB1 Rabbit pAb (A6248) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 80s.