BNIP2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: BNIP2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6282
• Supplier Catalog Number: A6282
• Alternative Catalog Number: ABB-A6282-20UL,ABB-A6282-100UL,ABB-A6282-1000UL,ABB-A6282-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NIP2, BNIP-2, BNIP2

Product Description

This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of BCL2, another apoptotic protector. Alternate splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 36kDa
• NCBI: 663
• UniProt: Q12982
• Purity: Affinity purification
• Sequence: VELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRVDMKAIEPYKKVISHGGY
• Target: BNIP2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag

Images

Western blot analysis of various lysates using BNIP2 Rabbit pAb (A6282) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.