AGFG1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A6294
Article Name: AGFG1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A6294
Supplier Catalog Number: A6294
Alternative Catalog Number: ABB-A6294-20UL,ABB-A6294-100UL,ABB-A6294-500UL,ABB-A6294-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HRB, RAB, RIP, AGFG1
The protein encoded by this gene is related to nucleoporins, a class of proteins that mediate nucleocytoplasmic transport. The encoded protein binds the activation domain of the human immunodeficiency virus Rev protein when Rev is assembled onto its RNA target, and is required for the nuclear export of Rev-directed RNAs. Multiple transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 3267
UniProt: P52594
Purity: Affinity purification
Sequence: MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPTLHLNKGTPSQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSGSSNF
Target: AGFG1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of various lysates using AGFG1 Rabbit pAb (A6294) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.