CANT1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CANT1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6341
• Supplier Catalog Number: A6341
• Alternative Catalog Number: ABB-A6341-20UL,ABB-A6341-100UL,ABB-A6341-1000UL,ABB-A6341-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: DBQD, EDM7, DBQD1, SCAN1, SHAPY, SCAN-1, CANT1

Product Description

This protein encoded by this gene belongs to the apyrase family. It functions as a calcium-dependent nucleotidase with a preference for UDP. Mutations in this gene are associated with Desbuquois dysplasia with hand anomalies. Alternatively spliced transcript variants have been noted for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 45kDa
• NCBI: 124583
• UniProt: Q8WVQ1
• Purity: Affinity purification
• Sequence: HRPAPGRPPTHNAHNWRLGQAPANWYNDTYPLSPPQRTPAGIRYRIAVIADLDTESRAQEENTWFSYLKKGYLTLSDSGDKVAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEGSKAVPWVILSDGDGTVEKGFKAEWLAVKDERLYVGGLGK
• Target: CANT1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag

Images

Western blot analysis of various lysates using (A6341) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.