CLIC1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CLIC1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6363
• Supplier Catalog Number: A6363
• Alternative Catalog Number: ABB-A6363-500UL,ABB-A6363-1000UL,ABB-A6363-100UL,ABB-A6363-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: G6, CL1C1, NCC27, CLCNL1, CLIC1

Product Description

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family, the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 27kDa
• NCBI: 1192
• UniProt: O00299
• Purity: Affinity purification
• Sequence: NVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
• Target: CLIC1

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Neuroscience,Calcium Signaling. Shipping: Ice Bag

Images

Western blot analysis of various lysates using CLIC1 Rabbit pAb (A6363) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.