LIPA Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: LIPA Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6385
• Supplier Catalog Number: A6385
• Alternative Catalog Number: ABB-A6385-20UL,ABB-A6385-100UL,ABB-A6385-1000UL,ABB-A6385-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: LAL, CESD, LIPA

Product Description

This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase). This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 45kDa
• NCBI: 3988
• UniProt: P38571
• Purity: Affinity purification
• Sequence: DAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLV
• Target: LIPA
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Lipases,Cardiovascular,Lipids. Shipping: Ice Bag

Images

Western blot analysis of various lysates using LIPA Rabbit pAb (A6385) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.