LYVE1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: LYVE1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6452
• Supplier Catalog Number: A6452
• Alternative Catalog Number: ABB-A6452-20UL,ABB-A6452-100UL,ABB-A6452-500UL,ABB-A6452-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HAR, XLKD1, LYVE-1, CRSBP-1, LYVE1

Product Description

This gene encodes a type I integral membrane glycoprotein. The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 35kDa
• NCBI: 10894
• UniProt: Q9Y5Y7
• Purity: Affinity purification
• Sequence: LVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPT
• Target: LYVE1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cardiovascular. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse brain, using LYVE1 Rabbit pAb (A6452) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.