POLR3K Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A6467
Article Name: POLR3K Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A6467
Supplier Catalog Number: A6467
Alternative Catalog Number: ABB-A6467-100UL,ABB-A6467-20UL,ABB-A6467-500UL,ABB-A6467-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: C11, HLD21, My010, RPC10, RPC11, RPC12.5, C11-RNP3, POLR3K
This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. Pseudogenes of this gene are found on chromosomes 13 and 17.
Clonality: Polyclonal
Molecular Weight: 12kDa
NCBI: 51728
UniProt: Q9Y2Y1
Purity: Affinity purification
Sequence: MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
Target: POLR3K
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using POLR3K Rabbit pAb (A6467) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.