NGB Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: NGB Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6477
• Supplier Catalog Number: A6477
• Alternative Catalog Number: ABB-A6477-500UL,ABB-A6477-20UL,ABB-A6477-100UL,ABB-A6477-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NGB

Product Description

This gene encodes an oxygen-binding protein that is distantly related to members of the globin gene family. It is highly conserved among other vertebrates. It is expressed in the central and peripheral nervous system where it may be involved in increasing oxygen availability and providing protection under hypoxic/ischemic conditions.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 17kDa
• NCBI: 58157
• UniProt: Q9NPG2
• Purity: Affinity purification
• Sequence: MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
• Target: NGB

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse brain, using NGB Rabbit pAb (A6477) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.