CD200 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CD200 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6552
• Supplier Catalog Number: A6552
• Alternative Catalog Number: ABB-A6552-100UL,ABB-A6552-20UL,ABB-A6552-1000UL,ABB-A6552-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MRC, MOX1, MOX2, OX-2, CD200

Product Description

This gene encodes a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 31kDa
• NCBI: 4345
• UniProt: P41217
• Purity: Affinity purification
• Sequence: AQVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKGYWFSVPLL
• Target: CD200
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Immunology Inflammation,CDs,Cardiovascular. Shipping: Ice Bag

Images

Western blot analysis of various lysates using CD200 Rabbit pAb (A6552) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.