DLK1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: DLK1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6578
• Supplier Catalog Number: A6578
• Alternative Catalog Number: ABB-A6578-100UL,ABB-A6578-20UL,ABB-A6578-500UL,ABB-A6578-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: DLK, FA1, ZOG, pG2, DLK-1, PREF1, Delta1, Pref-1, DLK1

Product Description

This gene encodes a transmembrane protein that contains multiple epidermal growth factor repeats that functions as a regulator of cell growth. The encoded protein is involved in the differentiation of several cell types including adipocytes. This gene is located in a region of chromosome 14 frequently showing unparental disomy, and is imprinted and expressed from the paternal allele. A single nucleotide variant in this gene is associated with child and adolescent obesity and shows polar overdominance, where heterozygotes carrying an active paternal allele express the phenotype, while mutant homozygotes are normal.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 41kDa
• NCBI: 8788
• UniProt: P80370
• Purity: Affinity purification
• Sequence: ELCDRDVRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNL
• Target: DLK1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Signal Transduction,Endocrine Metabolism,Neuroscience,Calcium Signaling,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse heart, using DLK1 Rabbit pAb (A6578) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.