NLRP12 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: NLRP12 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6671
• Supplier Catalog Number: A6671
• Alternative Catalog Number: ABB-A6671-20UL,ABB-A6671-100UL,ABB-A6671-500UL,ABB-A6671-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: RNO, PAN6, RNO2, FCAS2, NALP12, PYPAF7, CLR19.3, NLRP12

Product Description

This gene encodes a member of the CATERPILLER family of cytoplasmic proteins. The encoded protein, which contains an N-terminal pyrin domain, a NACHT domain, a NACHT-associated domain, and a C-terminus leucine-rich repeat region, functions as an attenuating factor of inflammation by suppressing inflammatory responses in activated monocytes. Mutations in this gene cause familial cold autoinflammatory syndrome type 2. Alternative splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 120kDa
• NCBI: 91662
• UniProt: P59046
• Purity: Affinity purification
• Sequence: WLKICRLTAAACDELASTLSVNQSLRELDLSLNELGDLGVLLLCEGLRHPTCKLQTLRLGICRLGSAACEGLSVVLQANHNLRELDLSFNDLGDWGLWLLAEGLQHPACRLQKLWLDSCGLTAKACENLYFTLGINQTLTDLYLTNNALGDTGVRLLCKRLSHPGCKLRVLWLFGMDLNKMTHSRLAALRVTKPYLDIGC
• Target: NLRP12
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Caspases. Shipping: Ice Bag

Images

Western blot analysis of various lysates using NLRP12 Rabbit pAb (A6671) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.