Phospholipid Scramblase 1 (PLSCR1) Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Phospholipid Scramblase 1 (PLSCR1) Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6691
• Supplier Catalog Number: A6691
• Alternative Catalog Number: ABB-A6691-100UL,ABB-A6691-20UL,ABB-A6691-1000UL,ABB-A6691-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MMTRA1B, Phospholipid Scramblase 1 (PLSCR1)

Product Description

This gene encodes a phospholipid scramblase family member. The encoded protein is involved in disruption of the asymmetrical distribution of phospholipids between the inner and outer leaflets of the plasma membrane, resulting in externalization of phosphatidylserine. This cell membrane disruption plays an important role in the blood coagulation cascade as well as macrophage clearing of apoptotic cells. The encoded protein has additionally been implicated in gene regulation and interferon-induced antiviral responses.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 35kDa
• NCBI: 5359
• UniProt: O15162
• Purity: Affinity purification
• Sequence: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSLDEQCV
• Target: PLSCR1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Neuroscience,Calcium Signaling,Cardiovascular,Lipids. Shipping: Ice Bag

Images

Western blot analysis of various lysates using Phospholipid Scramblase 1 (PLSCR1) Rabbit pAb (A6691) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.