PNPLA3 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PNPLA3 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6694
• Supplier Catalog Number: A6694
• Alternative Catalog Number: ABB-A6694-100UL,ABB-A6694-20UL,ABB-A6694-500UL,ABB-A6694-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ADPN, C22orf20, iPLA(2)epsilon, PNPLA3

Product Description

The protein encoded by this gene is a triacylglycerol lipase that mediates triacylglycerol hydrolysis in adipocytes. The encoded protein, which appears to be membrane bound, may be involved in the balance of energy usage/storage in adipocytes.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 53kDa
• NCBI: 80339
• UniProt: Q9NST1
• Purity: Affinity purification
• Sequence: PDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCTPEQDWPCWTPCSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKSL
• Target: PNPLA3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Lipases,Cardiovascular,Lipids. Shipping: Ice Bag

Images

Western blot analysis of various lysates using PNPLA3 Rabbit pAb (A6694) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.