SNAP91 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SNAP91 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6746
• Supplier Catalog Number: A6746
• Alternative Catalog Number: ABB-A6746-20UL,ABB-A6746-100UL,ABB-A6746-1000UL,ABB-A6746-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CALM, AP180, SNAP91

Product Description

Predicted to enable several functions, including SNARE binding activity, clathrin binding activity, and phosphatidylinositol binding activity. Acts upstream of or within regulation of clathrin-dependent endocytosis. Predicted to be located in several cellular components, including postsynaptic density, presynaptic endosome, and presynaptic membrane. Predicted to be extrinsic component of endosome membrane. Predicted to be active in several cellular components, including Schaffer collateral - CA1 synapse, cytoplasmic vesicle, and parallel fiber to Purkinje cell synapse. Predicted to be extrinsic component of presynaptic endocytic zone membrane. Biomarker of Alzheimers disease.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 93kDa
• NCBI: 9892
• UniProt: O60641
• Purity: Affinity purification
• Sequence: AVPVSTSKPSSDLLDLQPDFSSGGAAAAAAPAPPPPAGGATAWGGFGGSFMAPSPSPVTPAQNNLLQPNFEAAFGTTPSTSSSSSFDPSVFDGLGDLLMPTMAPAGQPAPVSMVPPSPAMAASKALGSDLDSSLASLVGNLGISGTTTKKGDLQWNAGEKKLTGGANWQPKVAPATWSAGVPPSAPLQGAVPPTSSVPPVAGAPSVGQPGAGFGMPPAGTGMPMMPQQPVMFAQPMMRPPFGAAAVPGTQLSPSP
• Target: SNAP91
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience, Cell Type Marker,Neuron marker,Synapse marker. Shipping: Ice Bag

Images

Western blot analysis of various lysates using SNAP91 Rabbit pAb (A6746) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.