ST8SIA4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A6754
Article Name: ST8SIA4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A6754
Supplier Catalog Number: A6754
Alternative Catalog Number: ABB-A6754-20UL,ABB-A6754-100UL,ABB-A6754-1000UL,ABB-A6754-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PST, PST1, SIAT8D, ST8SIA-IV, ST8SIA4
The protein encoded by this gene catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). The encoded protein, which is a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 7903
UniProt: Q92187
Purity: Affinity purification
Sequence: YKTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR
Target: ST8SIA4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. Shipping: Ice Bag
Western blot analysis of various lysates using ST8SIA4 Rabbit pAb (A6754) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.