RECQL4 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: RECQL4 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6846
• Supplier Catalog Number: A6846
• Alternative Catalog Number: ABB-A6846-100UL,ABB-A6846-20UL,ABB-A6846-500UL,ABB-A6846-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: RECQ4, RECQL4

Product Description

The protein encoded by this gene is a DNA helicase that belongs to the RecQ helicase family. DNA helicases unwind double-stranded DNA into single-stranded DNAs and may modulate chromosome segregation. This gene is predominantly expressed in thymus and testis. Mutations in this gene are associated with Rothmund-Thomson, RAPADILINO and Baller-Gerold syndromes.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 133kDa
• NCBI: 9401
• UniProt: O94761
• Purity: Affinity purification
• Sequence: GAGSQGPEASAFQEVSIRVGSPQPSSSGGEKRRWNEEPWESPAQVQQESSQAGPPSEGAGAVAVEEDPPGEPVQAQPPQPCSSPSNPRYHGLSPSSQARA
• Target: RECQL4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair. Shipping: Ice Bag

Images

Western blot analysis of various lysates using RECQL4 Rabbit pAb (A6846) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.