SLC1A5 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SLC1A5 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6981
• Supplier Catalog Number: A6981
• Alternative Catalog Number: ABB-A6981-20UL,ABB-A6981-100UL,ABB-A6981-500UL,ABB-A6981-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: R16, AAAT, ATBO, M7V1, RDRC, ASCT2, M7VS1, SLC1A5

Product Description

The SLC1A5 gene encodes a sodium-dependent neutral amino acid transporter that can act as a receptor for RD114/type D retrovirus (Larriba et al., 2001 [PubMed 11781704]).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 57kDa
• NCBI: 6510
• UniProt: Q15758
• Purity: Affinity purification
• Sequence: QPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRSYSTTYEERNITGTRVKVPVGQ
• Target: SLC1A5
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag

Images

Western blot analysis of various lysates using SLC1A5 Rabbit pAb (A6981) at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:30s.