SMC1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SMC1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7008
• Supplier Catalog Number: A7008
• Alternative Catalog Number: ABB-A7008-20UL,ABB-A7008-100UL,ABB-A7008-500UL,ABB-A7008-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: SMC1, SMCB, CDLS2, DEE85, SB1.8, EIEE85, SMC1L1, DXS423E, SMC1alpha

Product Description

Proper cohesion of sister chromatids is a prerequisite for the correct segregation of chromosomes during cell division. The cohesin multiprotein complex is required for sister chromatid cohesion. This complex is composed partly of two structural maintenance of chromosomes (SMC) proteins, SMC3 and either SMC1B or the protein encoded by this gene. Most of the cohesin complexes dissociate from the chromosomes before mitosis, although those complexes at the kinetochore remain. Therefore, the encoded protein is thought to be an important part of functional kinetochores. In addition, this protein interacts with BRCA1 and is phosphorylated by ATM, indicating a potential role for this protein in DNA repair. This gene, which belongs to the SMC gene family, is located in an area of the X-chromosome that escapes X inactivation. Mutations in this gene result in Cornelia de Lange syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 143kDa
• NCBI: 8243
• UniProt: Q14683
• Purity: Affinity purification
• Sequence: MGFLKLIEIENFKSYKGRQIIGPFQRFTAIIGPNGSGKSNLMDAISFVLGEKTSNLRVKTLRDLIHGAPVGKPAANRAFVSMVYSEEGAEDRTFARVIVGGSSEYKINNKVVQLHEYSEELEKLGILIKA
• Target: SMC1A
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Protein phosphorylation,ATM Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Cell Cycle. Shipping: Ice Bag

Images

Western blot analysis of various lysates using SMC1 Rabbit pAb (A7008) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.