GITR Ligand/TNFSF18 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7028
Article Name: GITR Ligand/TNFSF18 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7028
Supplier Catalog Number: A7028
Alternative Catalog Number: ABB-A7028-100UL,ABB-A7028-20UL,ABB-A7028-500UL,ABB-A7028-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TL6, AITRL, GITRL, TNLG2A, hGITRL, GITR Ligand/TNFSF18
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.
Clonality: Polyclonal
Molecular Weight: 20kDa
NCBI: 8995
UniProt: Q9UNG2
Purity: Affinity purification
Sequence: CSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSE
Target: TNFSF18
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Growth factors,Immunology Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway,Cardiovascular. Shipping: Ice Bag
Western blot analysis of lysates from Rat skeletal muscle, using GITR Ligand/TNFSF18 Rabbit pAb (A7028) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.