RRAS2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: RRAS2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7076
• Supplier Catalog Number: A7076
• Alternative Catalog Number: ABB-A7076-100UL,ABB-A7076-20UL,ABB-A7076-1000UL,ABB-A7076-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NS12, TC21, RRAS2

Product Description

This gene encodes a member of the R-Ras subfamily of Ras-like small GTPases. The encoded protein associates with the plasma membrane and may function as a signal transducer. This protein may play an important role in activating signal transduction pathways that control cell proliferation. Mutations in this gene are associated with the growth of certain tumors. Pseudogenes of this gene are found on chromosomes 1 and 2. Alternate splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 23kDa
• NCBI: 22800
• UniProt: P62070
• Purity: Affinity purification
• Sequence: MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
• Target: RRAS2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,G protein signaling,Small G proteins,G-Protein-Coupled Receptors Signaling to MAPK Erk,ErbB-HER Signaling Pathway,MAPK-Erk Signaling Pathway,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Cytoskeleton,Actins,Endocrine Metabolism,Warburg Effect,Immunology Inflammation,T Cell Receptor Signaling Pathway. Shipping: Ice Bag

Images

Western blot analysis of various lysates using RRAS2 Rabbit pAb (A7076) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.