DPP8 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: DPP8 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A7113
• Supplier Catalog Number: A7113
• Alternative Catalog Number: ABB-A7113-20UL,ABB-A7113-100UL,ABB-A7113-1000UL,ABB-A7113-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: DP8, DPRP1, DPRP-1, MST097, MSTP097, MSTP135, MSTP141, DPP8

Product Description

This gene encodes a member of the peptidase S9B family, a small family of dipeptidyl peptidases that are able to cleave peptide substrates at a prolyl bond. The encoded protein shares similarity with dipeptidyl peptidase IV in that it is ubiquitously expressed, and hydrolyzes the same substrates. These similarities suggest that, like dipeptidyl peptidase IV, this protein may play a role in T-cell activation and immune function. Alternatively spliced transcript variants encoding different isoforms have been described.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 103kDa
• NCBI: 54878
• UniProt: Q6V1X1
• Purity: Affinity purification
• Sequence: IKSGKCNMAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKTINRAAVLMLSWKPLLDLFQATLDYGMYSREEELLRERKRIGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPDWIAF
• Target: DPP8
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Ubiquitin. Shipping: Ice Bag

Images

Western blot analysis of various lysates using DPP8 Rabbit pAb (A7113) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.